PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma239g00210.1
Common NameZOSMA_239G00210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 545aa    MW: 60584.9 Da    PI: 7.7501
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma239g00210.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.3e-103333701954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Zosma239g00210.1 333 FEHflHPYPTDTDKHMLAKQTGLTRNQVSNWFINARVR 370
                       665559******************************88 PP

2BELL66.35.9e-221822441072
              BELL  10 akLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       a L+s l+eV+k  kqy +ql+ +is+Fe vagl +a+pY+slA+  +SrhF  +kdai++++
  Zosma239g00210.1 182 AWLISTLNEVYKVCKQYLHQLKSIISAFESVAGLSNAAPYASLAMESMSRHFCRIKDAICDHL 244
                       679*********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-17105242IPR006563POX domain
PfamPF075262.8E-24110240IPR006563POX domain
PROSITE profilePS5007112.212311374IPR001356Homeobox domain
SMARTSM003893.1E-10314378IPR001356Homeobox domain
CDDcd000862.75E-13314375No hitNo description
SuperFamilySSF466892.4E-17316381IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28317378IPR009057Homeodomain-like
PfamPF059201.1E-18331370IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MSEIYRGGEQ QQQVVVAGMG DGLLGSPMMS MYHVPQQSRR EKLRYPSSEE NPLSLVPTST  60
TINPHHLQNH SHLAPSSSSI PLQKSLNGDQ HHNSIPRPSP MEPFTGYAAV LDGSKFLIPT  120
QNMLAELCDV GLGRYGGVAG FDDHNESLAE LQMVVDQLRL EDMNQKYTSD AGVGSDQRRI  180
EAWLISTLNE VYKVCKQYLH QLKSIISAFE SVAGLSNAAP YASLAMESMS RHFCRIKDAI  240
CDHLCYTQKA HFQLISNEDS SKKKNEEKYQ VGAGNGSSYF RRTPRPPTPL EGSSANNPRS  300
SSSNNNHNNN NYVWRPQRGL PEKAVAVLKA WLFEHFLHPY PTDTDKHMLA KQTGLTRNQV  360
SNWFINARVR LWKPMVEEIH SLEQRQSKKV QIPAIFKTSS EQQQLPSPSM MPSTSSTADL  420
LNVKQASNAT HFFRDVQNAL SSVVTVDIPP PCNFSSPVDT YSRQQQQQQH TSNNHIGGYS  480
TGVSLTLGLQ QNNNTTASIS ESIPLNVARH FGFEDDYIPA MSLAAVSKNV VNTGQQQFLR  540
DFIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B7e-16320378563Homeobox protein Meis2
3k2a_A7e-16320378563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0K9PHR10.0A0A0K9PHR1_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.16e-64TALE family protein